PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_5.248
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 583aa    MW: 64161.2 Da    PI: 6.5157
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_5.248genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.61.2e-33252309260
                                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                  +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  evm.model.supercontig_5.248 252 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITEIVYKGSHNHPK 309
                                  8****************************************.***************85 PP

2WRKY105.33.2e-33413471159
                                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+ver+++d ++v++tYeg+Hnh+
  evm.model.supercontig_5.248 413 LDDGYRWRKYGQKVVKGNPNPRSYYKCTTVGCPVRKHVERASQDVRAVITTYEGKHNHD 471
                                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.3E-28241310IPR003657WRKY domain
SuperFamilySSF1182904.05E-25245310IPR003657WRKY domain
PROSITE profilePS5081123.606246310IPR003657WRKY domain
SMARTSM007741.3E-36251309IPR003657WRKY domain
PfamPF031062.0E-25252308IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.1E-37398473IPR003657WRKY domain
SuperFamilySSF1182905.36E-29405473IPR003657WRKY domain
PROSITE profilePS5081138.262408473IPR003657WRKY domain
SMARTSM007742.0E-38413472IPR003657WRKY domain
PfamPF031062.0E-25414471IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 583 aa     Download sequence    Send to blast
MASSSSSSTN SHASFSLASS TDTQFMASSS SLVRMDNTNQ NTNPITWGLS VSDQLTDRIS  60
VEIPKFKSLA PSSLPFSPPA VSPSSFLATT PAFTHTDFLD SPVLFSASNL LASPTTGAFA  120
GQTFNWRSNS GDDDQQTIKR EDNSFGDFSF QTQPKPNSTT SSSPIFQSSS NVVSMEESIK  180
KQEEIWNFDK STKQQQHDFS LGKTGAKSDF APLECFSTEI NPFQSSNAGA QSSFSQYNSQ  240
PCQYVREQRR AEDGYNWRKY GQKQVKGSEN PRSYYKCTFP NCPTKKKVER SLDGQITEIV  300
YKGSHNHPKP QARRSSSHSI CNNSEISDQS GSLLDTHQTD SFMIRDDTSG SMGEDDLEQG  360
SPMSNLGGED DDTEPEAKRW KGDMENEGII GTGSRTVREP RIVVQTTSDI DILDDGYRWR  420
KYGQKVVKGN PNPRSYYKCT TVGCPVRKHV ERASQDVRAV ITTYEGKHNH DVPAARGSSY  480
TLNRPSINGS NSSSMVMPIR PFVVATHSNN HLNYPNSLQS ARPATQAPTT FEILQNAVNF  540
GFSGFGKPAG SFMNQSQQSA AVFPRAKEEP RDDDSFLDSF LS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-34239474578Probable WRKY transcription factor 4
1wj2_A1e-34239474578Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026547.10.0RNI-like superfamily protein
SwissprotQ8S8P51e-143WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A061EXQ10.0A0A061EXQ1_THECC; RNI-like superfamily protein
STRINGPOPTR_0016s13600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-130WRKY DNA-binding protein 33